PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G381900.1.p
Common NameLOC101772402, SETIT_022238mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 401aa    MW: 43377.5 Da    PI: 6.8039
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G381900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.41.6e-1494131340
                 TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         +k+C+CkkskClk+YC Cfa+g++C+e+C Ce C Nk 
  Seita.3G381900.1.p  94 CKTCSCKKSKCLKLYCVCFASGSHCTESCGCEPCLNKP 131
                         89**********************************96 PP

2TCR48.71.5e-15170205439
                 TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         ++C+Ckks ClkkYC+Cf+ g+ Cs +CkCedC+N 
  Seita.3G381900.1.p 170 RKCTCKKSGCLKKYCDCFQGGAGCSINCKCEDCRNP 205
                         79********************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.8E-1092133IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.27693207IPR005172CRC domain
PfamPF036381.9E-1095130IPR005172CRC domain
SMARTSM011141.1E-15167208IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.1E-11170204IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MDAEEEPPKA PQPEPAGSEP DDARSTPPPA PPPPPPPAPT PAPAPVVPAP AAEAAAAPPA  60
PVSAAVSPPP AAAAEANGNS DRKKKRKTED GEGCKTCSCK KSKCLKLYCV CFASGSHCTE  120
SCGCEPCLNK PMQGAPRTAL VLPLKPVQTL ETGQDSMEQL IRSPMDLIRR KCTCKKSGCL  180
KKYCDCFQGG AGCSINCKCE DCRNPFGRKV GVILDGKSAL AAPVLNERNG AEVDSSDDED  240
DYYMNRQLSP IPPSPVSRES SFQQETLVGV EVQTMNGHLY PKPLTQVRPE PPSWQLSRRP  300
VEEARGEQWR FSRRPSEDGT SDAMEAHAMA QRDNKKPEIH VDRFSIPRCI EVMSAMADLS  360
PIEKSLAPDV FLDPSNREIF LSLSVDIRPI WLRRKMKSLV *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963115.10.0PREDICTED: protein tesmin/TSO1-like CXC 7
TrEMBLK3Z6R90.0K3Z6R9_SETIT; Uncharacterized protein
STRINGSi022238m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP96102834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-25TESMIN/TSO1-like CXC 2